CFam Chemical Families Database
BIDD Pharmainformatics Databases
 
   
Click on CFAM IDs and names to search or view in CFAM, click on external IDs to view the entity in its source database.

CFam Family Information

CFAM Family ID CFFAD136
Family Name Epidermal Growth Factor family
No. of Seeds 111 No. of Other Members 209
Family Centroid CFAMM00024381 Functional Category Approved Drug with Human Metabolite
Superfamily Peptide hormone receptor bindng peptide Superfamily
Class Class 20

Cousin Family NamesSeedsMembers
Leutinizing-hormone-releasing hormone inhibitor peptide Leupro... 43 911
Gonadotropin-releasing hormone receptor Ligand decapeptide ana... 9 162
Gastrin/cholecystokinin type B receptor ligand peptide Pentaga... 26 1171
Parathyroid hormone/parathyroid hormone-related peptide recept... 55 256
Somatostatin receptor type 2 ligand octapeptide Octreotide Family 27 172
Insulin receptor Ligand Insulin, Porcine Family 61 205
Insulin-degrading enzyme inhibitor cyclic polypeptide Bacitrac... 30 259
Gastrin/cholecystokinin type B receptor ligand oligopeptide Ce... 35 209
Renin Inhibitor Remikiren Family 100 126
Bacterial outer membrane Inhibitor Daptomycin Family 6 50
Somatostatin receptor type 2 ligand octapeptide Lanreotide Family 93 156
ostatin receptor 5 Ligand Pasireotide Diaspartate Family 11 151
Growth hormone receptor Ligand EP-51216 Family 34 390
NS5A protein Inhibitor Bms 790052 Family 5 9
CBP-501 family 7 8
AEZS-108 family 5 2
Eluxadoline family 4 85
Cholecystokinin receptor type A Ligand A-71378 Family 77 23
Gastrin/cholecystokinin type B receptor Ligand PD136450 Family 53 117
Lethal factor Inhibitor GM6001 Family 50 435
Renin Inhibitor Enalkiren Family 56 44
Renin Inhibitor (h-261)boc-his-pro-phe-his-leu(oh)-val-ile-his... 33 41
Integrin alpha-V and Integrin beta-3 Inhibitor SB-223245 Family 27 36
Cathepsin B and Cathepsin K Inhibitor Z-arg-leu-val-agly-ile-v... 3 19
Cathepsin B and Cathepsin K Inhibitor Z-ala-leu-his-agly-ile-v... 3 2
Renin Inhibitor Sul-pro-phe-n-mehis-lva-ile-amp Family 47 54
Delta-type opioid receptor and Gastrin/cholecystokinin type B ... 19 0
Melanocortin receptor 3 and Melanocortin receptor 4 Ligand C[n... 12 10
Melanocortin receptor Ligand Ac-his-dnal(2)-arg-trp-nh2 Family 112 67
Delta-type opioid receptor and Mu-type opioid receptor Ligand ... 50 17
Melanocortin receptor 3 and Melanocortin receptor 4 Ligand Ac-... 38 60
Melanocortin receptor 3 and Melanocortin receptor 4 Ligand C[c... 20 18
D(2) dopamine receptor and D(3) dopamine receptor Ligand D-366... 5 75
Type-1 angiotensin II receptor Ligand [sar1,tdf3]angii Family 135 2
Reverse transcriptase Inhibitor Atevirdine Family 4 55
Endothelin B receptor Ligand IRL-2500 Family 34 87
Vasopressin V1a receptor and Vasopressin V1b receptor Ligand D... 10 19
Delta-type opioid receptor and Mu-type opioid receptor Ligand ... 18 72
Delta-type opioid receptor and Mu-type opioid receptor Ligand ... 13 15
Melanocortin receptor Ligand Ac-his-dphe(3,4-dicl)-arg-trp-nh2... 10 14
Somatostatin receptor type 1 and Somatostatin receptor type 2 ... 46 0
Bombesin receptor subtype-3 and Gastrin-releasing peptide rece... 42 7
Prothrombin and Cationic trypsin inhibitor (2S)-N-[(2S)-1-(1H-... 4 15
Pol polyprotein inhibitor penicillin deriv. 71 family 1 2
Glucagon-like peptide 1 receptor ligand CHEMBL1092373 family 5 2
Protein farnesyltransferase subunit beta and Protein farnesylt... 3 0
Somatostatin receptor type 2 ligand tert-butyl (2S)-6-amino-2-... 1 2
Neprilysin and Angiotensin-converting enzyme inhibitor (2S)-3-... 8 3
Pol polyprotein and Renin inhibitor U-75875 family 12 1
Placenta growth factor inhibitor CHEMBL1689479 family 4 1
Endothelin-1 receptor and Endothelin B receptor ligand SureCN9... 3 10
Pol polyprotein inhibitor propan-2-yl N-[(2S)-1-[[(2S,3S,5R)-3... 6 2
Histone deacetylase inhibitor (3S,6S,9S,12R)-3-[(2S)-butan-2-y... 1 0
Relaxin-3 receptor 1 and Relaxin-3 receptor 2 ligand CHEMBL203... 4 1
Platelet-derived growth factor receptor alpha and Vascular end... 3 1
RAC-alpha serine/threonine-protein kinase inhibitor 5-[5-[(2S)... 3 1
Growth hormone secretagogue receptor type 1 ligand SureCN36660... 4 14
KiSS-1 receptor ligand (2S)-N-[(2S)-1-[[(2S)-4-amino-1-[[(2S)-... 3 0
Gastrin/cholecystokinin type B receptor ligand CHEMBL2386886 f... 1 0
Mu-type opioid receptor and Delta-type opioid receptor ligand ... 1 0
Melanocortin receptor 4 ligand CHEMBL2415084 family 3 0
Melanocyte-stimulating hormone receptor and Melanocortin recep... 1 0
Coagulation factor VII inhibitor CHEMBL269354 family 1 0
Neutrophil collagenase and Stromelysin-3 inhibitor [3-[[1-amin... 3 2
Renin inhibitor tert-butyl N-[(2S)-1-[[(2S)-1-[[(1R,2S)-3-cycl... 3 0
Pol polyprotein and Protease inhibitor 161186-51-2 family 5 0
Substance-P receptor ligand N-[(2R)-1-[acetyl-[(2-chlorophenyl... 2 2
Renin inhibitor (2R)-2-benzyl-N-[(2S)-1-[[(2S,3R,4S)-1-cyclohe... 6 0
Melanocyte-stimulating hormone receptor and Melanocortin recep... 1 0
Neuropeptide Y receptor type 2 ligand CHEMBL411765 family 1 0
KiSS-1 receptor ligand N-[(2S)-1-[[2-[[(2S)-1-[[(2S)-1-[[(2S)-... 1 0
Epidermal growth factor receptor ligand CHEMBL437469 family 1 0
Histone deacetylase 1 inhibitor (7S)-N-hydroxy-7-[[2-(5-methox... 1 2
Mitogen-activated protein kinase 1 and Aurora kinase A inhibit... 1 0
Cholecystokinin receptor type A and Gastrin/cholecystokinin ty... 1 0
Growth factor receptor-bound protein 2 ligand [4-[(2S)-2-aceta... 2 1
E3 ubiquitin-protein ligase Mdm2 and Protein Mdm4 inhibitor CH... 2 1
Glucagon receptor ligand CHEMBL267876 family 1 0
Coagulation factor VII inhibitor CHEMBL410836 family 1 0


CFAM Mol ID

External ID

Functional Category

Molecule Name

CFAMM00024381 DNAP001521 Approved Drug Epidermal growth factor
CFAMM00024177 DAP001037 Approved Drug Glucagon recombinant
CFAMM00024232 DAP000284 Approved Drug Cosyntropin
CFAMM00024339 DAP000157 Approved Drug Enfuvirtide
CFAMM00024143 CHEMBL410763 Bioactive (4S)-4-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-acetamido-3-hydroxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]-5-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-amino-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-5-oxopentanoic acid
CFAMM00024434 CHEMBL2114259 Bioactive CHEMBL2114259
CFAMM00024106 CHEMBL413912 Bioactive CHEMBL413912
CFAMM00024173 CHEMBL1790963 Bioactive CHEMBL1790963
CFAMM00024236 CHEMBL439181 Bioactive CHEMBL439181
CFAMM00024213 CHEMBL1222088 Bioactive CHEMBL1222088
CFAMM00024292 CHEMBL428460 Bioactive CHEMBL428460
CFAMM00024172 CHEMBL1790962 Bioactive CHEMBL1790962
CFAMM00024272 CHEMBL214332 Bioactive ALPHA-MSH
CFAMM00024235 CHEMBL1790959 Bioactive CHEMBL1790959
CFAMM00024395 CHEMBL409577 Bioactive CHEMBL409577
CFAMM00024422 CHEMBL412488 Bioactive CHEMBL412488
CFAMM00024212 CHEMBL1222089 Bioactive CHEMBL1222089
CFAMM00024113 CHEMBL438733 Bioactive CHEMBL438733
CFAMM00024432 CHEMBL427748 Bioactive CHEMBL427748
CFAMM00024171 CHEMBL1790960 Bioactive CHEMBL1790960
CFAMM00024185 CHEMBL1222101 Bioactive CHEMBL1222101
CFAMM00024147 CHEMBL1834392 Bioactive CHEMBL1834392
CFAMM00024203 CHEMBL386081 Bioactive (4S)-4-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-acetamido-3-hydroxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]-5-[[(2S)-1-[[(2R)-1-[[(2S)-5-(diaminomethylideneamino)-1-[[(2S)-1-[[2-[[(2S)-1,6-diamino-1-oxohexan-2-yl]amino]-2-oxoethyl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-5-oxopentanoic acid
CFAMM00024263 CHEMBL437648 Bioactive CHEMBL437648
CFAMM00024372 CHEMBL412003 Bioactive CHEMBL412003
CFAMM00024240 CHEMBL1790180 Bioactive ENDOTHELIN 3
CFAMM00024154 CHEMBL2115248 Bioactive CHEMBL2115248
CFAMM00024445 CHEMBL414286 Bioactive CHEMBL414286
CFAMM00024184 CHEMBL1222100 Bioactive CHEMBL1222100
CFAMM00024132 CHEMBL437472 Bioactive Endothelin-1
CFAMM00024146 CHEMBL1834391 Bioactive CHEMBL1834391
CFAMM00024217 CHEMBL1222081 Bioactive CHEMBL1222081
CFAMM00024406 CHEMBL411171 Bioactive CHEMBL411171
CFAMM00024419 CHEMBL1240919 Bioactive CHEMBL1240919
CFAMM00024246 CHEMBL2373273 Bioactive CHEMBL1790179
CFAMM00024324 CHEMBL405796 Bioactive CHEMBL405796
CFAMM00024438 CHEMBL2304284 Bioactive ENDOTHELIN 2
CFAMM00024254 CHEMBL407559 Bioactive CHEMBL407559
CFAMM00024386 CHEMBL441738 Bioactive Ndp-msh
CFAMM00024224 CHEMBL266192 Bioactive (3S)-3-amino-4-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[(2S)-2-[[(1S)-1-carboxy-2-(1H-indol-3-yl)ethyl]carbamoyl]pyrrolidin-1-yl]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-oxobutanoic acid
CFAMM00024444 CHEMBL2373291 Bioactive CHEMBL1790958
CFAMM00024216 CHEMBL1222087 Bioactive CHEMBL1222087
CFAMM00024138 CHEMBL415660 Bioactive CHEMBL415660
CFAMM00024207 CHEMBL2415082 Bioactive CHEMBL2415082
CFAMM00024356 CHEMBL442316 Bioactive CHEMBL442316
CFAMM00024411 CHEMBL438027 Bioactive CHEMBL438027
CFAMM00024316 CHEMBL1222092 Bioactive CHEMBL1222092
CFAMM00024443 CHEMBL2373292 Bioactive CHEMBL1790961
CFAMM00024268 CHEMBL265775 Bioactive (4S)-4-amino-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-[(2S)-2-(carboxymethylcarbamoyl)pyrrolidin-1-yl]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-5-oxopentanoic acid
CFAMM00024315 CHEMBL1222095 Bioactive CHEMBL1222095
CFAMM00024442 CHEMBL263581 Bioactive CHEMBL263581
CFAMM00024128 DNCL002918 Clinical Trial Drug Semaglutide
CFAMM00024378 DCL000108 Clinical Trial Drug Ecallantide
CFAMM00024276 DCL000869 Clinical Trial Drug Liraglutide
CFAMM00024188 DNCL001913 Clinical Trial Drug Recombinant relaxin
CFAMM00024273 DNC008909 Investigative Drug [Gly8,Glu22]GLP-1(7,37)-NH2
CFAMM00024121 DNC009008 Investigative Drug Endothelin-3
CFAMM00024096 DNC012429 Investigative Drug Compound RES-701-1(1-10)/[A15]ET-1
CFAMM00024279 DNC008907 Investigative Drug c[Glu18-Lys22][Gly8]GLP-1(7-37)-NH2
CFAMM00024389 DNC008910 Investigative Drug [Gly8]GLP-1(7-37)-NH2
CFAMM00024402 DNC005532 Investigative Drug Ac-YR[CEHdFRWC]-NH2
CFAMM00024353 DNC004893 Investigative Drug Des-His1[Glu9]glucagon-NH2
CFAMM00024380 DNC004831 Investigative Drug Ac-I[CVYQDWGAHRC]T-NH2
CFAMM00024120 DNC009004 Investigative Drug NDP-alpha-MSH
CFAMM00024344 DNC008897 Investigative Drug c[Asp22-Lys26][Gly8]GLP-1(7-37)-NH2
CFAMM00024408 DNC012318 Investigative Drug RES-701-1
CFAMM00024278 DNC008904 Investigative Drug c[Glu21-Lys25][Gly8]GLP-1(7-37)-NH2
CFAMM00024141 DNC005522 Investigative Drug Ac-YR[CEHdFRWC]SPPKD-NH2
CFAMM00024401 DNC005533 Investigative Drug Ac-YR[CEHFRWC]-NH2
CFAMM00024414 DNC012448 Investigative Drug Compound RES-701-1(1-10)/[A15]ET-3
CFAMM00024133 DNC008896 Investigative Drug c[hGlu22-Lys26][Gly8]GLP-1(7-37)-NH2
CFAMM00024298 DNC010522 Investigative Drug GwTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH2
CFAMM00024343 DNC008893 Investigative Drug c[Glu21-Lys26][Gly8]GLP-1(7-37)-NH2
CFAMM00024277 DNC008905 Investigative Drug Glu20-Lys24][Gly8][GLP-1(7-37)-NH2
CFAMM00024140 DNC005521 Investigative Drug Ac-YRMEHdFRWGSPPKD-NH2
CFAMM00024351 DNC005541 Investigative Drug Ac-YCit[CEHdFRWC]-NH2
CFAMM00024371 DNC012446 Investigative Drug Compound SRTX6b
CFAMM00024139 DNC005520 Investigative Drug GPYRMEHFRWGSPPKD-NH2
CFAMM00024200 DNC005518 Investigative Drug NDP-SYSMEHFRWGKPVG
CFAMM00024282 DNC008902 Investigative Drug c[Glu23-Lys27][Gly8]GLP-1(7-37)-NH2
CFAMM00024309 DNC007518 Investigative Drug Ser-Tyr-Ser-Nle-Glu-His-Dphe-Arg
CFAMM00024341 DNC008898 Investigative Drug c[Glu22-Orn26][Gly8]GLP-1(7-37)-NH2
CFAMM00024370 DNC012447 Investigative Drug Compound ET-3
CFAMM00024109 DNC012452 Investigative Drug Compound RES-701-1(1-10)/[A15]SRTX6b
CFAMM00024168 DNC011540 Investigative Drug Trp-Ile-Ile-Asp-Leu-Hisc(Cys-Ser-Val-Tyr-Phe-Cys)
CFAMM00024281 DNC008900 Investigative Drug c[Glu26-Lys30][Gly8]GLP-1(7-37)-NH2
CFAMM00024349 DNC005542 Investigative Drug Ac-YK[CEHdFRWC]-NH2
CFAMM00024100 DNC005057 Investigative Drug NH2-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-CONH2
CFAMM00024199 DNC005519 Investigative Drug AEKKDEGPYRMEHFRWGSPPKD
CFAMM00024294 DNC009333 Investigative Drug HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR
CFAMM00024308 DNC010633 Investigative Drug endothelin-2
CFAMM00024274 DNC008908 Investigative Drug [Gly8, aib22]GLP-1(7-37)-NH2
CFAMM00024108 DNC012451 Investigative Drug linear peptide of RES-701-1
CFAMM00024301 DNC010524 Investigative Drug WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2
CFAMM00024369 DNC012442 Investigative Drug Compound [S15]ET-1
CFAMM00024280 DNC008901 Investigative Drug c[Glu24-Lys28][Gly8]GLP-1(7-37)-NH2
CFAMM00024347 DNC008894 Investigative Drug HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2

Statistics of CFAM Database

 
CFAM currently contains 490,279 molecules in 87,136 families, 34,880 superfamilies and 11,643 classes.
 

How to cite our database

 
C. Zhang, L. Tao, C. Qin, P. Zhang, S.Y. Chen, X. Zeng, F. Xu, Z. Chen, S.Y. Yang and Y.Z. CFam: A Chemical Families Database Based on Iterative Selection of Functional Seeds and Seed-Directed Compound Clustering. Nucl. Acids Res. 43 (D1): D558-D565 (2015) (First published online: November 20, 2014).
 

Last update by

 
2014.08.29
 

 

21767 visits since 2014 .........

 



Dr. Chen Yuzong

Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543