CFam Chemical Families Database
BIDD Pharmainformatics Databases
 
   
Click on CFAM IDs and names to search or view in CFAM, click on external IDs to view the entity in its source database.

CFam Family Information

CFAM Family ID CFFAD298
Family Name Parathyroid hormone/parathyroid hormone-related peptide receptor ligand peptide Teriparatide Family
No. of Seeds 55 No. of Other Members 256
Family Centroid CFAMM00048289 Functional Category Approved Drug with Human Metabolite
Superfamily Peptide hormone receptor bindng peptide Superfamily
Class Class 20

Cousin Family NamesSeedsMembers
Leutinizing-hormone-releasing hormone inhibitor peptide Leupro... 43 911
Epidermal Growth Factor family 111 209
5-hydroxytryptamine receptor Ligand Ramosetron Family 10 219
Gastrin/cholecystokinin type B receptor ligand peptide Pentaga... 26 1171
Somatostatin receptor type 2 ligand octapeptide Octreotide Family 27 172
Insulin receptor Ligand Insulin, Porcine Family 61 205
Insulin-degrading enzyme inhibitor cyclic polypeptide Bacitrac... 30 259
Gastrin/cholecystokinin type B receptor ligand oligopeptide Ce... 35 209
Renin Inhibitor Remikiren Family 100 126
Indoleamine 2,3-dioxygenase 1 Inhibitor L-tryptophan Family 8 328
Bacterial outer membrane Inhibitor Daptomycin Family 6 50
Somatostatin receptor type 2 ligand octapeptide Lanreotide Family 93 156
ostatin receptor 5 Ligand Pasireotide Diaspartate Family 11 151
Substance-P receptor Ligand GSK424887 Family 8 184
Growth hormone receptor Ligand EP-51216 Family 34 390
Protein kinase C alpha type and Protein kinase C beta type Inh... 16 86
NS5A protein Inhibitor Bms 790052 Family 5 9
BIBT986 family 7 96
CBP-501 family 7 8
AEZS-108 family 5 2
Gonadotropin-releasing hormone Inhibitor ASP3550 Family 33 60
Vascular endothelial growth factor receptor 2 Ligand XL999 Family 11 87
Cholecystokinin receptor type A Ligand A-71378 Family 77 23
Gastrin/cholecystokinin type B receptor Ligand PD136450 Family 53 117
Lethal factor Inhibitor GM6001 Family 50 435
Platelet activating factor, putative Inhibitor ABT-491 Family 22 62
Renin Inhibitor Enalkiren Family 56 44
Somatostatin receptor type 2 Ligand L-054852 Family 13 88
Renin Inhibitor (h-261)boc-his-pro-phe-his-leu(oh)-val-ile-his... 33 41
Substance-K receptor and Substance-P receptor Ligand L-732138 ... 8 147
Integrin alpha-V and Integrin beta-3 Inhibitor SB-223245 Family 27 36
Cathepsin B and Cathepsin K Inhibitor Z-arg-leu-val-agly-ile-v... 3 19
Cathepsin B and Cathepsin K Inhibitor Z-ala-leu-his-agly-ile-v... 3 2
Renin Inhibitor Sul-pro-phe-n-mehis-lva-ile-amp Family 47 54
Delta-type opioid receptor and Gastrin/cholecystokinin type B ... 19 0
Melanocortin receptor 3 and Melanocortin receptor 4 Ligand C[n... 12 10
Melanocortin receptor Ligand Ac-his-dnal(2)-arg-trp-nh2 Family 112 67
Melanocortin receptor 3 and Melanocortin receptor 4 Ligand Ac-... 38 60
Delta-type opioid receptor Ligand H-poa-ser-gly-phe-leu-thr-oh... 5 12
Melanocortin receptor 3 and Melanocortin receptor 4 Ligand C[c... 20 18
Angiotensin-converting enzyme and Endothelin-converting enzyme... 2 10
Type-1 angiotensin II receptor Ligand [sar1,tdf3]angii Family 135 2
Endothelin B receptor Ligand IRL-2500 Family 34 87
Vasopressin V1a receptor and Vasopressin V1b receptor Ligand D... 10 19
Delta-type opioid receptor and Mu-type opioid receptor Ligand ... 18 72
Melanocortin receptor Ligand Ac-his-dphe(3,4-dicl)-arg-trp-nh2... 10 14
Somatostatin receptor type 1 and Somatostatin receptor type 2 ... 46 0
Bombesin receptor subtype-3 and Gastrin-releasing peptide rece... 42 7
Protein farnesyltransferase/geranylgeranyltransferase type-1 s... 1 2
Prothrombin and Cationic trypsin inhibitor (2S)-N-[(2S)-1-(1H-... 4 15
Pol polyprotein inhibitor penicillin deriv. 71 family 1 2
Mu-type opioid receptor and Mu-type opioid receptor ligand Sur... 5 10
Glucagon-like peptide 1 receptor ligand CHEMBL1092373 family 5 2
Renin and Cathepsin D inhibitor tert-butyl N-[(2R)-1-[[3-[[(2R... 19 4
Renin and Pepsin A inhibitor tert-butyl N-[(2S)-1-[[2-[[(4S,5S... 4 0
Pol polyprotein inhibitor Hydroxyethylene deriv. 12 family 13 10
Pol polyprotein inhibitor N-[(2S)-1-[[(2S,3R,4S,5S)-3,4-dihydr... 2 0
Cholecystokinin receptor type A and Gastrin/cholecystokinin ty... 17 28
Protein farnesyltransferase/geranylgeranyltransferase type-1 s... 11 22
Growth hormone secretagogue receptor type 1 ligand 2-amino-N-[... 3 0
Macrophage colony-stimulating factor 1 receptor and Cytochrome... 13 3
Pol polyprotein inhibitor AC1LA3L0 family 3 2
Lysosomal Pro-X carboxypeptidase inhibitor N-[(2S)-1-[(2S)-2-(... 1 0
Gastrin/cholecystokinin type B receptor and Cholecystokinin re... 3 3
Renin inhibitor propan-2-yl (3R)-2-hydroxy-3-[[(2S)-3-(1H-imid... 4 0
Renin and Cathepsin D inhibitor tert-butyl N-[(2S)-1-[[(2S)-1-... 2 2
Gonadotropin-releasing hormone receptor ligand 1-(7-azabicyclo... 4 4
Protein farnesyltransferase/geranylgeranyltransferase type-1 s... 6 3
Gonadotropin-releasing hormone receptor ligand 1-(3-azabicyclo... 9 10
Endothelin-1 receptor and Endothelin B receptor ligand SureCN9... 3 10
Baculoviral IAP repeat-containing protein 2 and Baculoviral IA... 1 0
Pol polyprotein inhibitor propan-2-yl N-[(2S)-1-[[(2S,3S,5R)-3... 6 2
Coagulation factor X and Coagulation factor IX inhibitor 5-ami... 9 4
Prothrombin and Cationic trypsin inhibitor (2S)-1-[(2R)-3,3-di... 5 9
Relaxin-3 receptor 1 and Relaxin-3 receptor 2 ligand CHEMBL203... 4 1
Somatostatin receptor type 3 ligand tert-butyl 4-[(3R)-3-(5-ph... 2 2
Melanocortin receptor 4 and Melanocortin receptor 5 ligand CHE... 1 0
C-C chemokine receptor type 5 ligand AC1MHRXO family 5 1
Growth hormone secretagogue receptor type 1 ligand SureCN36660... 4 14
Renin inhibitor tert-butyl N-[(2S)-1-[[(2S)-1-[[(2S,3S,5S)-5-(... 2 0
Somatostatin receptor type 3 and Somatostatin receptor type 4 ... 5 1
Gastrin/cholecystokinin type B receptor ligand CHEMBL2386886 f... 1 0
Melanocortin receptor 4 ligand CHEMBL2415084 family 3 0
Orexin receptor type 2 and Orexin receptor type 1 ligand 9-(4,... 2 8
Histone deacetylase 1 inhibitor 1-methyl-N-[(1S)-7-oxo-1-(5-qu... 2 3
Histone deacetylase 1 inhibitor 1-methyl-N-[(1S)-7-oxo-1-(5-qu... 2 1
Somatostatin receptor type 1 and Somatostatin receptor type 2 ... 3 0
RAF proto-oncogene serine/threonine-protein kinase and Serine/... 4 3
Neprilysin and Angiotensin-converting enzyme inhibitor (2S)-2-... 1 4
Orexin receptor type 2 and Orexin receptor type 1 ligand (2S)-... 2 2
Gastrin-releasing peptide receptor ligand (2S)-N-[(2S)-1-[[(2S... 1 0
Proteinase-activated receptor 1 and Prothrombin ligand (2S)-N-... 3 23
Melanocyte-stimulating hormone receptor and Melanocortin recep... 1 0
Endothelin B receptor and Endothelin-1 receptor ligand 2-[[(2R... 17 10
Renin inhibitor tert-butyl N-[(2S)-1-[[(2S)-1-[[(1R,2S)-3-cycl... 3 0
Substance-P receptor ligand (4R)-N-[(2R)-1-[benzyl(methyl)amin... 8 5
Renin inhibitor (2R)-2-benzyl-N-[(2S)-1-[[(2S,3R,4S)-1-cyclohe... 6 0
Protein farnesyltransferase/geranylgeranyltransferase type-1 s... 4 3
Melanocyte-stimulating hormone receptor and Melanocortin recep... 1 0
KiSS-1 receptor ligand SureCN5132924 family 2 4
Melanocortin receptor 3 and Melanocyte-stimulating hormone rec... 2 3
Growth hormone secretagogue receptor type 1 ligand CHEMBL52599... 1 0
Mitogen-activated protein kinase 1 and Aurora kinase A inhibit... 16 3
Melanocortin receptor 4 and Melanocortin receptor 5 ligand CHE... 1 1
Prolyl endopeptidase inhibitor 4-phenyl-1-[(2S,4S)-4-(4-pyridi... 2 1
Glucagon receptor ligand CHEMBL267876 family 1 0


CFAM Mol ID

External ID

Functional Category

Molecule Name

CFAMM00048289 DAP000396 Approved Drug Teriparatide
CFAMM00048085 DNAP001275 Approved Drug Teduglutide
CFAMM00048050 DAP001038 Approved Drug Exenatide
CFAMM00048024 DNAP001508 Approved Drug Teriparatide acetate
CFAMM00048154 CHEMBL2165327 Bioactive SARAFOTOXIN 6C
CFAMM00048156 CHEMBL1790178 Bioactive SARAFOTOXIN S6C
CFAMM00048015 DCL000444 Clinical Trial Drug AVE0010
CFAMM00048270 DNC004843 Investigative Drug Ac-I[CV(Bta)QDWGAHRC]T-NH2
CFAMM00048031 DNC004826 Investigative Drug Ac-I[CVVQDWGAHRC]T-NH2
CFAMM00048190 DNC005544 Investigative Drug Ac-dR[CEHdFRWC]-NH2
CFAMM00048283 DNC004837 Investigative Drug Ac-I[CV(Dht)QDWGAHRC]T
CFAMM00048235 DNC013614 Investigative Drug CCNCSSKWCRDHARCC
CFAMM00048263 DNC004844 Investigative Drug Ac-I[CV(Bpa)QDWGAHRC]T
CFAMM00048030 DNC004829 Investigative Drug Ac-I[CVHQDWGHHRC]T-NH2
CFAMM00048269 DNC004842 Investigative Drug Ac-I[CV(Bta)QDWGAHRC]T
CFAMM00048282 DNC004834 Investigative Drug Ac-I[CVWQDWGWHRC]T-NH2
CFAMM00048234 DNC013615 Investigative Drug CCNCSSKWCRAHSRCC
CFAMM00048210 DNC006705 Investigative Drug Ac-ICVWQD(5fW)GAHRCT-NH2
CFAMM00048262 DNC004849 Investigative Drug Ac-I[CVWQDWGAHRC]dT
CFAMM00048029 DNC004828 Investigative Drug Ac-I[CVSQDWGHHRC]T-NH2
CFAMM00048227 DNC009651 Investigative Drug Ac-WVTHRLAGLLS[Cit]SGGVVRKNFVPTDVGPFAF-NH2
CFAMM00048268 DNC004841 Investigative Drug Ac-I[CV(2Igl)QDWGAHRC]T-NH2
CFAMM00048139 DNC009647 Investigative Drug WVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
CFAMM00048281 DNC004835 Investigative Drug Ac-I[CVWQDWGHHRC]T-NH2
CFAMM00048233 DNC013612 Investigative Drug CCNCSSKWCRDHSRCC
CFAMM00048261 DNC004848 Investigative Drug Ac-I[CV(2Nal)QDWGAHRC]T-NH2
CFAMM00047999 DNC004725 Investigative Drug SRIF-28
CFAMM00048226 DNC009650 Investigative Drug Ac-WVTH[Cit]LAGLLSRSGGVVRKNFVPTDVGPFAF-NH2
CFAMM00048239 DNC013618 Investigative Drug CCACSSKWCRDHSRCC
CFAMM00048146 DNC008906 Investigative Drug c[Glu19-Lys23][Gly8]GLP-1(7-37)-NH2
CFAMM00048187 DNC008895 Investigative Drug c[Cpa19-Lys26][Gly8]GLP-1(7-37)-NH2
CFAMM00048254 DNC009573 Investigative Drug Ac-WVTHRLAGLLSRSGGVVRKNFVPTDVGPFAF-NH2
CFAMM00048267 DNC004840 Investigative Drug Ac-I[CV(2Igl)QDWGAHRC]T
CFAMM00048232 DNC013613 Investigative Drug ZNCCNCSSKWCRDHSRCC
CFAMM00048193 DNC005540 Investigative Drug Ac-[CEHdFRWC]-NH2
CFAMM00048225 DNC009653 Investigative Drug Ac-WVTH[hArg]LAGLLS[hArg]SGGVVRKNFVPTDVGPFAF-NH2
CFAMM00048238 DNC013619 Investigative Drug ZRCCNCSSKWCRDHSRCC
CFAMM00048253 DNC009574 Investigative Drug Ac-WVTH[Cit]LAGLLS[Cit]SGGVVRKNFVPTDVGPFAF-NH2
CFAMM00048266 DNC004847 Investigative Drug Ac-I[CV(2Nal)QDWGAHRC]T
CFAMM00048279 DNC004830 Investigative Drug Ac-I[CVFQDWGHHRC]T-NH2
CFAMM00048185 DNC013621 Investigative Drug SNEWIQPRLPQH
CFAMM00047971 DNC006710 Investigative Drug Ac-ICVWQDWGAHRCT-NH2
CFAMM00048192 DNC005543 Investigative Drug Ac-R[CEHdFRWC]-NH2
CFAMM00047986 DNC001272 Investigative Drug Sarafotoxin 6C
CFAMM00048207 DNC006708 Investigative Drug Ac-ICV(5MeW)QDWGAHRCT-NH2
CFAMM00048224 DNC009652 Investigative Drug Ac-WVTHQLAGLLSQSGGVVRKNFVPTDVGPFAF-NH2
CFAMM00048237 DNC013616 Investigative Drug CCNCSAKWCRDHSRCC
CFAMM00048265 DNC004846 Investigative Drug Ac-I[CV(1Nal)QDWGAHRC]T
CFAMM00048278 DNC004839 Investigative Drug Ac-I[CVWQDWG(Abu)HRC]T-NH2
CFAMM00048032 DNC004827 Investigative Drug Ac-I[CVTQDWGHHRC]T-NH2
CFAMM00048206 DNC006709 Investigative Drug Ac-ICV(5fW)QDWGAHRCT-NH2
CFAMM00048284 DNC004836 Investigative Drug Ac-I[CVWQDWGAHRC]T
CFAMM00048236 DNC013617 Investigative Drug CCNCASKWCRDHSRCC
CFAMM00048264 DNC004845 Investigative Drug Ac-I[CV(Bpa)QDWGAHRC]T-NH2
CFAMM00048229 DNC009654 Investigative Drug Ac-WVEHRLKGELSRKGGVV[hArg]KNFVPTDVGPFAF-NH2

Statistics of CFAM Database

 
CFAM currently contains 490,279 molecules in 87,136 families, 34,880 superfamilies and 11,643 classes.
 

How to cite our database

 
C. Zhang, L. Tao, C. Qin, P. Zhang, S.Y. Chen, X. Zeng, F. Xu, Z. Chen, S.Y. Yang and Y.Z. CFam: A Chemical Families Database Based on Iterative Selection of Functional Seeds and Seed-Directed Compound Clustering. Nucl. Acids Res. 43 (D1): D558-D565 (2015) (First published online: November 20, 2014).
 

Last update by

 
2014.08.29
 

 

21768 visits since 2014 .........

 



Dr. Chen Yuzong

Deputy Director of Center for Computational Science and Engineering
Professor in Department of Pharmacy
National University of Singapore, Singapore


All rights reserved.

   
 
 
Computer-aided Drug Design
about BIDD |  databases |  software |  teaching |  research |  links

 

Department of Computational Science | National University of Singapore | Blk S17, 3 Science Drive 2, Singapore 117543